SCOPe 2.07: Domain d1zhha_: 1zhh A:

Lineage for d1zhha_ (1zhh A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)

7. Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries)

8. Domain d1zhha_: 1zhh A: [125095]
   Other proteins in same PDB: d1zhhb1
   automated match to d1jx6a_
   complexed with nhe

Details for d1zhha_

PDB Entry: 1zhh, 1.94 Å

PDB Description: Crystal Structure of the Apo Form of Vibrio Harveyi LUXP Complexed with the Periplasmic Domain of LUXQ

PDB Compounds: (A:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d1zhha_:

Sequence; same for both SEQRES and ATOM records:

>d1zhha_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
tqvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdy
wvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhr
kfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyy
svlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfi
yacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamae
aikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn

Timeline for d1zhha_:

• d1zhha_ first appeared in SCOP 1.73, called d1zhha1
  
• d1zhha_ appears in SCOPe 2.06
  
• d1zhha_ appears in the current release, SCOPe 2.08