Lineage for d1zhha_ (1zhh A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008365Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1008366Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1008367Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1008554Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)
  7. 1008555Species Vibrio harveyi [TaxId:669] [69623] (3 PDB entries)
  8. 1008557Domain d1zhha_: 1zhh A: [125095]
    Other proteins in same PDB: d1zhhb1
    automated match to d1jx6a_
    complexed with nhe

Details for d1zhha_

PDB Entry: 1zhh (more details), 1.94 Å

PDB Description: Crystal Structure of the Apo Form of Vibrio Harveyi LUXP Complexed with the Periplasmic Domain of LUXQ
PDB Compounds: (A:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d1zhha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhha_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
tqvlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdy
wvrniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhr
kfvehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyy
svlyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfi
yacstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamae
aikwdledkpvptvysgdfeivtkadsperiealkkrafrysdn

SCOPe Domain Coordinates for d1zhha_:

Click to download the PDB-style file with coordinates for d1zhha_.
(The format of our PDB-style files is described here.)

Timeline for d1zhha_: