SCOP 1.75: Domain d1zhha1: 1zhh A:27-364

Lineage for d1zhha1 (1zhh A:27-364)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins)

6. Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)

7. Species Vibrio harveyi [TaxId:669] [69623] (3 PDB entries)

8. Domain d1zhha1: 1zhh A:27-364 [125095]
   Other proteins in same PDB: d1zhhb1
   automatically matched to d1jx6a_
   complexed with nhe

Details for d1zhha1

PDB Entry: 1zhh, 1.94 Å

PDB Description: Crystal Structure of the Apo Form of Vibrio Harveyi LUXP Complexed with the Periplasmic Domain of LUXQ

PDB Compounds: (A:) Autoinducer 2-binding periplasmic protein luxP

SCOP Domain Sequences for d1zhha1:

Sequence; same for both SEQRES and ATOM records:

>d1zhha1 c.93.1.1 (A:27-364) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
ledkpvptvysgdfeivtkadsperiealkkrafrysd

Timeline for d1zhha1:

• d1zhha1 first appeared in SCOP 1.73
  
• d1zhha1 is called d1zhha_ in SCOPe 2.01
  
• d1zhha1 appears in the current release, SCOPe 2.08, called d1zhha_