Lineage for d1zhbk_ (1zhb K:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2356942Protein beta2-microglobulin [88600] (7 species)
  7. 2357723Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2358017Domain d1zhbk_: 1zhb K: [125092]
    Other proteins in same PDB: d1zhba1, d1zhba2, d1zhbd1, d1zhbd2, d1zhbg1, d1zhbg2, d1zhbj1, d1zhbj2
    automated match to d1bz9b_

Details for d1zhbk_

PDB Entry: 1zhb (more details), 2.7 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
PDB Compounds: (K:) Beta-2-microglobulin

SCOPe Domain Sequences for d1zhbk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhbk_ b.1.1.2 (K:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1zhbk_:

Click to download the PDB-style file with coordinates for d1zhbk_.
(The format of our PDB-style files is described here.)

Timeline for d1zhbk_: