Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries) |
Domain d1zhbj1: 1zhb J:182-274 [125090] Other proteins in same PDB: d1zhba2, d1zhbb1, d1zhbd2, d1zhbe1, d1zhbg2, d1zhbh1, d1zhbj2, d1zhbk1 automatically matched to d1ddha1 |
PDB Entry: 1zhb (more details), 2.7 Å
SCOP Domain Sequences for d1zhbj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhbj1 b.1.1.2 (J:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
Timeline for d1zhbj1: