SCOP 1.73: Domain d1zhbd2: 1zhb D:3-180

Lineage for d1zhbd2 (1zhb D:3-180)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (15 PDB entries)

8. Domain d1zhbd2: 1zhb D:3-180 [125085]
   Other proteins in same PDB: d1zhba1, d1zhbb1, d1zhbd1, d1zhbe1, d1zhbg1, d1zhbh1, d1zhbj1, d1zhbk1
   automatically matched to d1ddha2

Details for d1zhbd2

PDB Entry: 1zhb, 2.7 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase

PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1zhbd2:

Sequence; same for both SEQRES and ATOM records:

>d1zhbd2 d.19.1.1 (D:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

Timeline for d1zhbd2:

• d1zhbd2 is new in SCOP 1.73
  
• d1zhbd2 appears in SCOP 1.75
  
• d1zhbd2 appears in the current release, SCOPe 2.08