Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
Domain d1zhba1: 1zhb A:182-274 [125081] Other proteins in same PDB: d1zhba2, d1zhbb_, d1zhbd2, d1zhbe_, d1zhbg2, d1zhbh_, d1zhbj2, d1zhbk_ automatically matched to d1ddha1 |
PDB Entry: 1zhb (more details), 2.7 Å
SCOPe Domain Sequences for d1zhba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhba1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
Timeline for d1zhba1: