Lineage for d1zh8b2 (1zh8 B:132-275)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 728336Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 728397Protein Hypothetical protein TM0312 [143544] (1 species)
  7. 728398Species Thermotoga maritima [TaxId:2336] [143545] (1 PDB entry)
  8. 728400Domain d1zh8b2: 1zh8 B:132-275 [125080]
    Other proteins in same PDB: d1zh8a1, d1zh8b1
    automatically matched to 1ZH8 A:132-275
    complexed with edo, na, nap

Details for d1zh8b2

PDB Entry: 1zh8 (more details), 2.5 Å

PDB Description: Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution
PDB Compounds: (B:) Oxidoreductase

SCOP Domain Sequences for d1zh8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh8b2 d.81.1.5 (B:132-275) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]}
hvpafwkakelvesgaigdpvfmnwqiwvgmdennkyvhtdwrkkpkhvggflsdggvhh
aaamrlilgeiewisavakdlspllggmdflssifefengtvgnytisyslkgnerfeit
gtkgkisiswdkivlneeemkvpq

SCOP Domain Coordinates for d1zh8b2:

Click to download the PDB-style file with coordinates for d1zh8b2.
(The format of our PDB-style files is described here.)

Timeline for d1zh8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zh8b1