Lineage for d1zh8b1 (1zh8 B:5-131,B:276-328)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1829119Protein Hypothetical protein TM0312 [141925] (1 species)
  7. 1829120Species Thermotoga maritima [TaxId:2336] [141926] (1 PDB entry)
    Uniprot Q9WYE8 4-131,276-328
  8. 1829122Domain d1zh8b1: 1zh8 B:5-131,B:276-328 [125079]
    Other proteins in same PDB: d1zh8a2, d1zh8b2
    automated match to d1zh8a1
    complexed with edo, na, nap

Details for d1zh8b1

PDB Entry: 1zh8 (more details), 2.5 Å

PDB Description: Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution
PDB Compounds: (B:) Oxidoreductase

SCOPe Domain Sequences for d1zh8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh8b1 c.2.1.3 (B:5-131,B:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]}
rkirlgivgcgiaarelhlpalknlshlfeitavtsrtrshaeefakmvgnpavfdsyee
llesglvdavdltlpvelnlpfiekalrkgvhvicekpistdvetgkkvvelseksektv
yiaenfrXensyqkefedfyqvvaegkpndlgspvqalkdlafieacvrsagnkvfvssl
l

SCOPe Domain Coordinates for d1zh8b1:

Click to download the PDB-style file with coordinates for d1zh8b1.
(The format of our PDB-style files is described here.)

Timeline for d1zh8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zh8b2