![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Hypothetical protein TM0312 [141925] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [141926] (1 PDB entry) Uniprot Q9WYE8 4-131,276-328 |
![]() | Domain d1zh8a1: 1zh8 A:4-131,A:276-328 [125077] Other proteins in same PDB: d1zh8a2, d1zh8b2 complexed with edo, na, nap |
PDB Entry: 1zh8 (more details), 2.5 Å
SCOP Domain Sequences for d1zh8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} lrkirlgivgcgiaarelhlpalknlshlfeitavtsrtrshaeefakmvgnpavfdsye ellesglvdavdltlpvelnlpfiekalrkgvhvicekpistdvetgkkvvelseksekt vyiaenfrXensyqkefedfyqvvaegkpndlgspvqalkdlafieacvrsagnkvfvss ll
Timeline for d1zh8a1: