Lineage for d1zh2b1 (1zh2 B:2-120)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691823Protein Transcriptional regulatory protein KdpE, N-terminal domain [142025] (1 species)
  7. 691824Species Escherichia coli [TaxId:562] [142026] (2 PDB entries)
  8. 691826Domain d1zh2b1: 1zh2 B:2-120 [125070]
    automatically matched to 1ZH2 A:2-120
    complexed with ca; mutant

Details for d1zh2b1

PDB Entry: 1zh2 (more details), 2 Å

PDB Description: Crystal Structure Of The Calcium-Bound Receiver Domain Of Kdp Potassium Transport System Response Regulator KdpE
PDB Compounds: (B:) KDP operon transcriptional regulatory protein kdpE

SCOP Domain Sequences for d1zh2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh2b1 c.23.1.1 (B:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]}
tnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdgi
efirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs

SCOP Domain Coordinates for d1zh2b1:

Click to download the PDB-style file with coordinates for d1zh2b1.
(The format of our PDB-style files is described here.)

Timeline for d1zh2b1: