SCOPe 2.08: Domain d1zh2b_: 1zh2 B:

Lineage for d1zh2b_ (1zh2 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186855] (10 PDB entries)

8. Domain d1zh2b_: 1zh2 B: [125070]
   Other proteins in same PDB: d1zh2a1
   automated match to d1mvoa_
   complexed with ca

Details for d1zh2b_

PDB Entry: 1zh2, 2 Å

PDB Description: crystal structure of the calcium-bound receiver domain of kdp potassium transport system response regulator kdpe

PDB Compounds: (B:) KDP operon transcriptional regulatory protein kdpE

SCOPe Domain Sequences for d1zh2b_:

Sequence; same for both SEQRES and ATOM records:

>d1zh2b_ c.23.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs

Timeline for d1zh2b_:

• d1zh2b_ first appeared in SCOP 1.73, called d1zh2b1
  
• d1zh2b_ appears in SCOPe 2.07