![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein Transcriptional regulatory protein KdpE, N-terminal domain [142025] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142026] (1 PDB entry) Uniprot P21866 2-120 |
![]() | Domain d1zh2a1: 1zh2 A:2-120 [125069] Other proteins in same PDB: d1zh2b_ complexed with ca |
PDB Entry: 1zh2 (more details), 2 Å
SCOPe Domain Sequences for d1zh2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} tnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdgi efirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs
Timeline for d1zh2a1: