Lineage for d1zgzd_ (1zgz D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464222Species Escherichia coli [TaxId:562] [186855] (10 PDB entries)
  8. 2464225Domain d1zgzd_: 1zgz D: [125068]
    Other proteins in same PDB: d1zgza1
    automated match to d1nxoa_
    complexed with gol, so4

Details for d1zgzd_

PDB Entry: 1zgz (more details), 1.8 Å

PDB Description: crystal structure of the receiver domain of tmao respiratory system response regulator torr
PDB Compounds: (D:) TorCAD operon transcriptional regulatory protein torR

SCOPe Domain Sequences for d1zgzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgzd_ c.23.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid

SCOPe Domain Coordinates for d1zgzd_:

Click to download the PDB-style file with coordinates for d1zgzd_.
(The format of our PDB-style files is described here.)

Timeline for d1zgzd_: