| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (54 species) not a true protein |
| Species Escherichia coli [TaxId:562] [186855] (6 PDB entries) |
| Domain d1zgzc_: 1zgz C: [125067] Other proteins in same PDB: d1zgza1 automated match to d1nxoa_ complexed with gol, so4 |
PDB Entry: 1zgz (more details), 1.8 Å
SCOPe Domain Sequences for d1zgzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zgzc_ c.23.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid
Timeline for d1zgzc_: