![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (7 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (25 proteins) |
![]() | Protein TorCAD operon transcriptional regulator TorD, N-terminal domain [142033] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142034] (1 PDB entry) |
![]() | Domain d1zgzc1: 1zgz C:2-121 [125067] automatically matched to 1ZGZ A:2-121 complexed with gol, so4; mutant |
PDB Entry: 1zgz (more details), 1.8 Å
SCOP Domain Sequences for d1zgzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zgzc1 c.23.1.1 (C:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid
Timeline for d1zgzc1: