SCOP 1.73: Domain d1zgzc1: 1zgz C:2-121

Lineage for d1zgzc1 (1zgz C:2-121)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein TorCAD operon transcriptional regulator TorD, N-terminal domain [142033] (1 species)

7. Species Escherichia coli [TaxId:562] [142034] (1 PDB entry)

8. Domain d1zgzc1: 1zgz C:2-121 [125067]
   automatically matched to 1ZGZ A:2-121
   complexed with gol, so4; mutant

Details for d1zgzc1

PDB Entry: 1zgz, 1.8 Å

PDB Description: crystal structure of the receiver domain of tmao respiratory system response regulator torr

PDB Compounds: (C:) TorCAD operon transcriptional regulatory protein torR

SCOP Domain Sequences for d1zgzc1:

Sequence; same for both SEQRES and ATOM records:

>d1zgzc1 c.23.1.1 (C:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}
phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid

Timeline for d1zgzc1:

• d1zgzc1 is new in SCOP 1.73
  
• d1zgzc1 appears in SCOP 1.75
  
• d1zgzc1 appears in the current release, SCOPe 2.08, called d1zgzc_