Lineage for d1zgzb1 (1zgz B:2-121)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691795Protein TorCAD operon transcriptional regulator TorD, N-terminal domain [142033] (1 species)
  7. 691796Species Escherichia coli [TaxId:562] [142034] (1 PDB entry)
  8. 691798Domain d1zgzb1: 1zgz B:2-121 [125066]
    automatically matched to 1ZGZ A:2-121
    complexed with gol, so4; mutant

Details for d1zgzb1

PDB Entry: 1zgz (more details), 1.8 Å

PDB Description: crystal structure of the receiver domain of tmao respiratory system response regulator torr
PDB Compounds: (B:) TorCAD operon transcriptional regulatory protein torR

SCOP Domain Sequences for d1zgzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgzb1 c.23.1.1 (B:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}
phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid

SCOP Domain Coordinates for d1zgzb1:

Click to download the PDB-style file with coordinates for d1zgzb1.
(The format of our PDB-style files is described here.)

Timeline for d1zgzb1: