Lineage for d1zgza1 (1zgz A:2-121)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825506Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 825507Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 825736Protein TorCAD operon transcriptional regulator TorD, N-terminal domain [142033] (1 species)
  7. 825737Species Escherichia coli [TaxId:562] [142034] (1 PDB entry)
    Uniprot P38684 2-121
  8. 825738Domain d1zgza1: 1zgz A:2-121 [125065]
    complexed with gol, so4; mutant

Details for d1zgza1

PDB Entry: 1zgz (more details), 1.8 Å

PDB Description: crystal structure of the receiver domain of tmao respiratory system response regulator torr
PDB Compounds: (A:) TorCAD operon transcriptional regulatory protein torR

SCOP Domain Sequences for d1zgza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}
phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid

SCOP Domain Coordinates for d1zgza1:

Click to download the PDB-style file with coordinates for d1zgza1.
(The format of our PDB-style files is described here.)

Timeline for d1zgza1: