Lineage for d1zgza1 (1zgz A:2-121)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855675Protein TorCAD operon transcriptional regulator TorD, N-terminal domain [142033] (1 species)
  7. 2855676Species Escherichia coli [TaxId:562] [142034] (1 PDB entry)
    Uniprot P38684 2-121
  8. 2855677Domain d1zgza1: 1zgz A:2-121 [125065]
    Other proteins in same PDB: d1zgzb_, d1zgzc_, d1zgzd_
    complexed with gol, so4

Details for d1zgza1

PDB Entry: 1zgz (more details), 1.8 Å

PDB Description: crystal structure of the receiver domain of tmao respiratory system response regulator torr
PDB Compounds: (A:) TorCAD operon transcriptional regulatory protein torR

SCOPe Domain Sequences for d1zgza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}
phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid

SCOPe Domain Coordinates for d1zgza1:

Click to download the PDB-style file with coordinates for d1zgza1.
(The format of our PDB-style files is described here.)

Timeline for d1zgza1: