Lineage for d1zgva1 (1zgv A:1A-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670861Protein Thrombin [50531] (2 species)
  7. 670908Species Human (Homo sapiens) [TaxId:9606] [50532] (163 PDB entries)
  8. 670996Domain d1zgva1: 1zgv A:1A-245 [125063]
    automatically matched to d1jwta_
    complexed with 501

Details for d1zgva1

PDB Entry: 1zgv (more details), 2.2 Å

PDB Description: Thrombin in complex with an oxazolopyridine inhibitor 2
PDB Compounds: (A:) thrombin

SCOP Domain Sequences for d1zgva1:

Sequence, based on SEQRES records: (download)

>d1zgva1 b.47.1.2 (A:1A-245) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
dcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

Sequence, based on observed residues (ATOM records): (download)

>d1zgva1 b.47.1.2 (A:1A-245) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
dcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgaslis
drwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynwre
nldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqpsvlqv
vnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqm
givswgegcdrdgkygfythvfrlkkwiqkvidqf

SCOP Domain Coordinates for d1zgva1:

Click to download the PDB-style file with coordinates for d1zgva1.
(The format of our PDB-style files is described here.)

Timeline for d1zgva1: