SCOPe 2.08: Domain d1zgub1: 1zgu B:1-76

Lineage for d1zgub1 (1zgu B:1-76)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin [54238] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries)
   Uniprot P62988
   identical sequence in many other species

8. Domain d1zgub1: 1zgu B:1-76 [125062]
   Other proteins in same PDB: d1zgua_

Details for d1zgub1

PDB Entry: 1zgu

PDB Description: solution structure of the human mms2-ubiquitin complex

PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d1zgub1:

Sequence; same for both SEQRES and ATOM records:

>d1zgub1 d.15.1.1 (B:1-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgg

Timeline for d1zgub1:

• d1zgub1 first appeared in SCOP 1.73
  
• d1zgub1 appears in SCOPe 2.07