Lineage for d1zgua1 (1zgu A:12-150)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1198735Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1198736Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1198737Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1198745Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1198807Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (3 PDB entries)
  8. 1198810Domain d1zgua1: 1zgu A:12-150 [125061]
    Other proteins in same PDB: d1zgub1
    automatically matched to d1j7da_

Details for d1zgua1

PDB Entry: 1zgu (more details)

PDB Description: Solution structure of the human Mms2-Ubiquitin complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 2

SCOPe Domain Sequences for d1zgua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgua1 d.20.1.1 (A:12-150) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
mskenmklpqppegqtynn

SCOPe Domain Coordinates for d1zgua1:

Click to download the PDB-style file with coordinates for d1zgua1.
(The format of our PDB-style files is described here.)

Timeline for d1zgua1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zgub1