Lineage for d1zgta2 (1zgt A:1085-1173)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383151Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2383152Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2383153Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2383154Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2383176Species Norway rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)
  8. 2383182Domain d1zgta2: 1zgt A:1085-1173 [125060]
    automated match to d1a5da2
    complexed with act

Details for d1zgta2

PDB Entry: 1zgt (more details), 1.45 Å

PDB Description: Structure of hydrogenated rat gamma E crystallin in H2O
PDB Compounds: (A:) Gamma crystallin E

SCOPe Domain Sequences for d1zgta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgta2 b.11.1.1 (A:1085-1173) beta-Crystallin {Norway rat (Rattus norvegicus), isoform E [TaxId: 10116]}
sshririyeredyrgqmveitddcphlqdrfhfsdfhsfhvmegywvlyempnyrgrqyl
lrpgeyrryhdwgamnarvgslrrimdfy

SCOPe Domain Coordinates for d1zgta2:

Click to download the PDB-style file with coordinates for d1zgta2.
(The format of our PDB-style files is described here.)

Timeline for d1zgta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zgta1