SCOP 1.73: Domain d1zgta2: 1zgt A:1085-1173

Lineage for d1zgta2 (1zgt A:1085-1173)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Rat (Rattus norvegicus), isoform E [TaxId:10116] [49704] (6 PDB entries)

8. Domain d1zgta2: 1zgt A:1085-1173 [125060]
   automatically matched to d1a5da2
   complexed with act

Details for d1zgta2

PDB Entry: 1zgt, 1.45 Å

PDB Description: Structure of hydrogenated rat gamma E crystallin in H2O

PDB Compounds: (A:) Gamma crystallin E

SCOP Domain Sequences for d1zgta2:

Sequence; same for both SEQRES and ATOM records:

>d1zgta2 b.11.1.1 (A:1085-1173) beta-Crystallin {Rat (Rattus norvegicus), isoform E [TaxId: 10116]}
sshririyeredyrgqmveitddcphlqdrfhfsdfhsfhvmegywvlyempnyrgrqyl
lrpgeyrryhdwgamnarvgslrrimdfy

Timeline for d1zgta2:

• d1zgta2 is new in SCOP 1.73
  
• d1zgta2 appears in SCOP 1.75
  
• d1zgta2 appears in the current release, SCOPe 2.08