Lineage for d1zgnb1 (1zgn B:77-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996931Protein Class pi GST [81347] (4 species)
  7. 1996932Species Human (Homo sapiens) [TaxId:9606] [47619] (53 PDB entries)
  8. 1996985Domain d1zgnb1: 1zgn B:77-209 [125057]
    Other proteins in same PDB: d1zgna2, d1zgnb2
    automated match to d1aqwa1
    complexed with fe, gsh, mes, no

Details for d1zgnb1

PDB Entry: 1zgn (more details), 2.1 Å

PDB Description: Crystal Structure of the Glutathione Transferase Pi in Complex with Dinitrosyl-diglutathionyl Iron Complex
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d1zgnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgnb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d1zgnb1:

Click to download the PDB-style file with coordinates for d1zgnb1.
(The format of our PDB-style files is described here.)

Timeline for d1zgnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zgnb2