Lineage for d1zgna2 (1zgn A:2-76)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1368986Protein Class pi GST [81358] (4 species)
  7. 1368987Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)
  8. 1369032Domain d1zgna2: 1zgn A:2-76 [125056]
    Other proteins in same PDB: d1zgna1, d1zgnb1
    automated match to d1aqwa2
    complexed with fe, gsh, mes, no

Details for d1zgna2

PDB Entry: 1zgn (more details), 2.1 Å

PDB Description: crystal structure of the glutathione transferase pi in complex with dinitrosyl-diglutathionyl iron complex
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d1zgna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgna2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d1zgna2:

Click to download the PDB-style file with coordinates for d1zgna2.
(The format of our PDB-style files is described here.)

Timeline for d1zgna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zgna1