Lineage for d1zglt2 (1zgl T:119-244)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029022Protein T-cell antigen receptor [49125] (7 species)
  7. 2029060Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)
  8. 2029094Domain d1zglt2: 1zgl T:119-244 [125052]
    Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zglb2, d1zgld1, d1zgld2, d1zgle1, d1zgle2, d1zglg1, d1zglg2, d1zglh1, d1zglh2, d1zglj1, d1zglj2, d1zglk1, d1zglk2, d1zglp1, d1zglp3, d1zglr1, d1zglr3, d1zglt1, d1zglt3, d1zglv1, d1zglv3
    automatically matched to d1bd2e2

Details for d1zglt2

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (T:) T cell receptor beta chain

SCOPe Domain Sequences for d1zglt2:

Sequence, based on SEQRES records: (download)

>d1zglt2 b.1.1.2 (T:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawg

Sequence, based on observed residues (ATOM records): (download)

>d1zglt2 b.1.1.2 (T:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevvfeishtqatlvclatgfypdhvelswwvnvhsgvstdpqplkeqpalnd
sryslssratwqnprhfrcqvqfyglsendewtqdrakpvtqivswg

SCOPe Domain Coordinates for d1zglt2:

Click to download the PDB-style file with coordinates for d1zglt2.
(The format of our PDB-style files is described here.)

Timeline for d1zglt2: