Lineage for d1zglt1 (1zgl T:3-118)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289755Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1289783Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (32 PDB entries)
  8. 1289820Domain d1zglt1: 1zgl T:3-118 [125051]
    Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zglb2, d1zgld1, d1zgld2, d1zgle1, d1zgle2, d1zglg1, d1zglg2, d1zglh1, d1zglh2, d1zglj1, d1zglj2, d1zglk1, d1zglk2, d1zglp2, d1zglr2, d1zglt2, d1zglv2
    automatically matched to d1bd2e1

Details for d1zglt1

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (T:) T cell receptor beta chain

SCOPe Domain Sequences for d1zglt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zglt1 b.1.1.1 (T:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfnetqrnkgnfpg
rfsgrqfsnsrsemnvstlelgdsalylcassladrvnteaffgqgtrltvve

SCOPe Domain Coordinates for d1zglt1:

Click to download the PDB-style file with coordinates for d1zglt1.
(The format of our PDB-style files is described here.)

Timeline for d1zglt1: