Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (38 PDB entries) probably orthologous to the mouse I-E group |
Domain d1zglh1: 1zgl H:93-189 [125041] Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb2, d1zgld1, d1zgld2, d1zgle2, d1zglg1, d1zglg2, d1zglh2, d1zglj1, d1zglj2, d1zglk2, d1zglp1, d1zglp2, d1zglr1, d1zglr2, d1zglt1, d1zglt2, d1zglv1, d1zglv2 automatically matched to d1fv1b1 |
PDB Entry: 1zgl (more details), 2.8 Å
SCOP Domain Sequences for d1zglh1:
Sequence, based on SEQRES records: (download)
>d1zglh1 b.1.1.2 (H:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewr
>d1zglh1 b.1.1.2 (H:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypanllvcsvngfypgsievrwfvvstgliqngdwtfqtlvmlesgevytc qvehpsvtspltvewr
Timeline for d1zglh1: