Lineage for d1zgle1 (1zgl E:93-189)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933150Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 933158Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 933213Domain d1zgle1: 1zgl E:93-189 [125037]
    Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb2, d1zgld1, d1zgld2, d1zgle2, d1zglg1, d1zglg2, d1zglh2, d1zglj1, d1zglj2, d1zglk2, d1zglp1, d1zglp2, d1zglr1, d1zglr2, d1zglt1, d1zglt2, d1zglv1, d1zglv2
    automatically matched to d1fv1b1

Details for d1zgle1

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (E:) major histocompatibility complex, class II, DR beta 5

SCOPe Domain Sequences for d1zgle1:

Sequence, based on SEQRES records: (download)

>d1zgle1 b.1.1.2 (E:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewr

Sequence, based on observed residues (ATOM records): (download)

>d1zgle1 b.1.1.2 (E:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvyprtnllvcsvngfypgsievrwfrnsqevvstgliqngdwtfqtlvmlep
rsgevytcqvehpsvtspltvewr

SCOPe Domain Coordinates for d1zgle1:

Click to download the PDB-style file with coordinates for d1zgle1.
(The format of our PDB-style files is described here.)

Timeline for d1zgle1: