| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (31 PDB entries) probably orthologous to the human HLA-DQ group |
| Domain d1zgld1: 1zgl D:83-179 [125035] Other proteins in same PDB: d1zgla2, d1zglb1, d1zglb2, d1zgld2, d1zgle1, d1zgle2, d1zglg2, d1zglh1, d1zglh2, d1zglj2, d1zglk1, d1zglk2, d1zglp1, d1zglp2, d1zglp3, d1zglr1, d1zglr2, d1zglr3, d1zglt1, d1zglt2, d1zglt3, d1zglv1, d1zglv2, d1zglv3 automatically matched to d1k2da1 |
PDB Entry: 1zgl (more details), 2.8 Å
SCOPe Domain Sequences for d1zgld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zgld1 b.1.1.2 (D:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe
Timeline for d1zgld1:
View in 3DDomains from other chains: (mouse over for more information) d1zgla1, d1zgla2, d1zglb1, d1zglb2, d1zgle1, d1zgle2, d1zglg1, d1zglg2, d1zglh1, d1zglh2, d1zglj1, d1zglj2, d1zglk1, d1zglk2, d1zglp1, d1zglp2, d1zglp3, d1zglr1, d1zglr2, d1zglr3, d1zglt1, d1zglt2, d1zglt3, d1zglv1, d1zglv2, d1zglv3 |