Lineage for d1zglb2 (1zgl B:1-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545475Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 2545490Domain d1zglb2: 1zgl B:1-92 [125034]
    Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zgld1, d1zgld2, d1zgle1, d1zglg1, d1zglg2, d1zglh1, d1zglj1, d1zglj2, d1zglk1, d1zglp1, d1zglp2, d1zglp3, d1zglr1, d1zglr2, d1zglr3, d1zglt1, d1zglt2, d1zglt3, d1zglv1, d1zglv2, d1zglv3
    automatically matched to d1fv1b2

Details for d1zglb2

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (B:) major histocompatibility complex, class II, DR beta 5

SCOPe Domain Sequences for d1zglb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zglb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey
wnsqkdfledrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1zglb2:

Click to download the PDB-style file with coordinates for d1zglb2.
(The format of our PDB-style files is described here.)

Timeline for d1zglb2: