Lineage for d1zglb1 (1zgl B:93-189)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654956Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 654964Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (38 PDB entries)
    probably orthologous to the mouse I-E group
  8. 655017Domain d1zglb1: 1zgl B:93-189 [125033]
    Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb2, d1zgld1, d1zgld2, d1zgle2, d1zglg1, d1zglg2, d1zglh2, d1zglj1, d1zglj2, d1zglk2, d1zglp1, d1zglp2, d1zglr1, d1zglr2, d1zglt1, d1zglt2, d1zglv1, d1zglv2
    automatically matched to d1fv1b1

Details for d1zglb1

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (B:) major histocompatibility complex, class II, DR beta 5

SCOP Domain Sequences for d1zglb1:

Sequence, based on SEQRES records: (download)

>d1zglb1 b.1.1.2 (B:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewr

Sequence, based on observed residues (ATOM records): (download)

>d1zglb1 b.1.1.2 (B:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvyprtnllvcsvngfypgsievrwfnsvvstgliqngdwtfqtlvmletvpr
sgevytcqvehpsvtspltvewr

SCOP Domain Coordinates for d1zglb1:

Click to download the PDB-style file with coordinates for d1zglb1.
(The format of our PDB-style files is described here.)

Timeline for d1zglb1: