Lineage for d1zgla2 (1zgl A:13-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545290Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2545388Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)
  8. 2545401Domain d1zgla2: 1zgl A:13-81 [125032]
    Other proteins in same PDB: d1zgla1, d1zglb1, d1zglb2, d1zgld1, d1zgle1, d1zgle2, d1zglg1, d1zglh1, d1zglh2, d1zglj1, d1zglk1, d1zglk2, d1zglp1, d1zglp2, d1zglp3, d1zglr1, d1zglr2, d1zglr3, d1zglt1, d1zglt2, d1zglt3, d1zglv1, d1zglv2, d1zglv3
    automatically matched to d1k2da2

Details for d1zgla2

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1zgla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgla2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

SCOPe Domain Coordinates for d1zgla2:

Click to download the PDB-style file with coordinates for d1zgla2.
(The format of our PDB-style files is described here.)

Timeline for d1zgla2: