SCOPe 2.08: Domain d1zg7a_: 1zg7 A:

Lineage for d1zg7a_ (1zg7 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein automated matches [190397] (2 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [187266] (20 PDB entries)

8. Domain d1zg7a_: 1zg7 A: [125014]
   automated match to d1z5ra1
   complexed with p20, zn

Details for d1zg7a_

PDB Entry: 1zg7, 1.75 Å

PDB Description: Crystal Structure of 2-(5-{[amino(imino)methyl]amino}-2-chlorophenyl)-3-sulfanylpropanoic acid Bound to Activated Porcine Pancreatic Carboxypeptidase B

PDB Compounds: (A:) Procarboxypeptidase B

SCOPe Domain Sequences for d1zg7a_:

Sequence; same for both SEQRES and ATOM records:

>d1zg7a_ c.56.5.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
tghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifm
dcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknr
mwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfir
nnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpg
attiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtny
vlghl

Timeline for d1zg7a_:

• d1zg7a_ first appeared in SCOP 1.73, called d1zg7a1
  
• d1zg7a_ appears in SCOPe 2.07