Lineage for d1zg5a1 (1zg5 A:151-216)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984691Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1984723Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 1984732Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species)
  7. 1984733Species Escherichia coli [TaxId:562] [46902] (5 PDB entries)
  8. 1984741Domain d1zg5a1: 1zg5 A:151-216 [125010]
    automatically matched to d1a04a1
    protein/DNA complex; complexed with so4

Details for d1zg5a1

PDB Entry: 1zg5 (more details), 2.3 Å

PDB Description: NarL complexed to narG-89 promoter palindromic tail-to-tail DNA site
PDB Compounds: (A:) nitrate/nitrite response regulator protein narl

SCOPe Domain Sequences for d1zg5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zg5a1 a.4.6.2 (A:151-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}
rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
hqerif

SCOPe Domain Coordinates for d1zg5a1:

Click to download the PDB-style file with coordinates for d1zg5a1.
(The format of our PDB-style files is described here.)

Timeline for d1zg5a1: