Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins) contains additional, fourth helix in the C-terminal extension |
Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species) |
Species Escherichia coli [TaxId:562] [46902] (5 PDB entries) |
Domain d1zg1f1: 1zg1 F:151-216 [125008] automatically matched to d1a04a1 complexed with so4 |
PDB Entry: 1zg1 (more details), 2.3 Å
SCOP Domain Sequences for d1zg1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zg1f1 a.4.6.2 (F:151-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv hqerif
Timeline for d1zg1f1: