Lineage for d1zg1f1 (1zg1 F:151-216)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 635945Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 635976Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 635985Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species)
  7. 635986Species Escherichia coli [TaxId:562] [46902] (5 PDB entries)
  8. 636001Domain d1zg1f1: 1zg1 F:151-216 [125008]
    automatically matched to d1a04a1
    complexed with so4

Details for d1zg1f1

PDB Entry: 1zg1 (more details), 2.3 Å

PDB Description: NarL complexed to nirB promoter non-palindromic tail-to-tail DNA site
PDB Compounds: (F:) nitrate/nitrite response regulator protein narl

SCOP Domain Sequences for d1zg1f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zg1f1 a.4.6.2 (F:151-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}
rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
hqerif

SCOP Domain Coordinates for d1zg1f1:

Click to download the PDB-style file with coordinates for d1zg1f1.
(The format of our PDB-style files is described here.)

Timeline for d1zg1f1: