SCOP 1.73: Domain d1zfla1: 1zfl A:1-67

Lineage for d1zfla1 (1zfl A:1-67)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family)

5. Family g.30.1.1: Carboxypeptidase inhibitor [57621] (1 protein)

6. Protein Carboxypeptidase inhibitor [57622] (1 species)

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (4 PDB entries)

8. Domain d1zfla1: 1zfl A:1-67 [125001]
   automatically matched to d1dtva_

Details for d1zfla1

PDB Entry: 1zfl

PDB Description: solution structure of iii-a, the major intermediate in the oxidative folding of leech carboxypeptidase inhibitor

PDB Compounds: (A:) Metallocarboxypeptidase inhibitor

SCOP Domain Sequences for d1zfla1:

Sequence; same for both SEQRES and ATOM records:

>d1zfla1 g.30.1.1 (A:1-67) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
gshtpdesflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrt
tcipyve

Timeline for d1zfla1:

• d1zfla1 is new in SCOP 1.73
  
• d1zfla1 appears in SCOP 1.75
  
• d1zfla1 appears in the current release, SCOPe 2.08, called d1zfla2