Class g: Small proteins [56992] (85 folds) |
Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily) disulfide-rich, alpha+beta |
Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) |
Family g.30.1.1: Carboxypeptidase inhibitor [57621] (1 protein) |
Protein Carboxypeptidase inhibitor [57622] (1 species) |
Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (4 PDB entries) |
Domain d1zfla1: 1zfl A:1-67 [125001] automatically matched to d1dtva_ |
PDB Entry: 1zfl (more details)
SCOP Domain Sequences for d1zfla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zfla1 g.30.1.1 (A:1-67) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} gshtpdesflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrt tcipyve
Timeline for d1zfla1: