Lineage for d1zfla1 (1zfl A:1-67)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749815Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 749816Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) (S)
  5. 749817Family g.30.1.1: Carboxypeptidase inhibitor [57621] (1 protein)
  6. 749818Protein Carboxypeptidase inhibitor [57622] (1 species)
  7. 749819Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (4 PDB entries)
  8. 749823Domain d1zfla1: 1zfl A:1-67 [125001]
    automatically matched to d1dtva_

Details for d1zfla1

PDB Entry: 1zfl (more details)

PDB Description: solution structure of iii-a, the major intermediate in the oxidative folding of leech carboxypeptidase inhibitor
PDB Compounds: (A:) Metallocarboxypeptidase inhibitor

SCOP Domain Sequences for d1zfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zfla1 g.30.1.1 (A:1-67) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
gshtpdesflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrt
tcipyve

SCOP Domain Coordinates for d1zfla1:

Click to download the PDB-style file with coordinates for d1zfla1.
(The format of our PDB-style files is described here.)

Timeline for d1zfla1: