Lineage for d1zfla2 (1zfl A:2-67)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034964Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 3034965Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) (S)
  5. 3034966Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins)
  6. 3034967Protein Carboxypeptidase inhibitor [57622] (1 species)
  7. 3034968Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (5 PDB entries)
  8. 3034973Domain d1zfla2: 1zfl A:2-67 [125001]
    Other proteins in same PDB: d1zfla3
    automated match to d1dtva_

Details for d1zfla2

PDB Entry: 1zfl (more details)

PDB Description: solution structure of iii-a, the major intermediate in the oxidative folding of leech carboxypeptidase inhibitor
PDB Compounds: (A:) Metallocarboxypeptidase inhibitor

SCOPe Domain Sequences for d1zfla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zfla2 g.30.1.1 (A:2-67) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
shtpdesflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrtt
cipyve

SCOPe Domain Coordinates for d1zfla2:

Click to download the PDB-style file with coordinates for d1zfla2.
(The format of our PDB-style files is described here.)

Timeline for d1zfla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zfla3