Lineage for d1zeta2 (1zet A:27-299)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743539Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 743608Protein DNA polymerase iota [111295] (1 species)
  7. 743609Species Human (Homo sapiens) [TaxId:9606] [111296] (8 PDB entries)
  8. 743611Domain d1zeta2: 1zet A:27-299 [124998]
    Other proteins in same PDB: d1zeta1
    automatically matched to d1t3na2
    complexed with bru, doc, mg, ttp

Details for d1zeta2

PDB Entry: 1zet (more details), 2.3 Å

PDB Description: X-ray data do not support hoogsteen base-pairing during replication by human polymerase iota
PDB Compounds: (A:) polymerase (DNA directed) iota

SCOP Domain Sequences for d1zeta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeta2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
srvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdake
kcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsd
elsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnklla
klvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfsp
kilekelgisvaqriqklsfgednspvilsgpp

SCOP Domain Coordinates for d1zeta2:

Click to download the PDB-style file with coordinates for d1zeta2.
(The format of our PDB-style files is described here.)

Timeline for d1zeta2: