![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein DNA polymerase iota [111295] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111296] (19 PDB entries) Uniprot Q9UNA4 |
![]() | Domain d1zeta2: 1zet A:27-299 [124998] Other proteins in same PDB: d1zeta1 automated match to d1t3na2 protein/DNA complex; complexed with mg, ttp |
PDB Entry: 1zet (more details), 2.3 Å
SCOPe Domain Sequences for d1zeta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zeta2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} srvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdake kcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsd elsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnklla klvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfsp kilekelgisvaqriqklsfgednspvilsgpp
Timeline for d1zeta2: