Lineage for d1zeta1 (1zet A:300-414)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008408Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 3008476Protein DNA polymerase iota [111015] (1 species)
  7. 3008477Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries)
    Uniprot Q9UNA4
  8. 3008485Domain d1zeta1: 1zet A:300-414 [124997]
    Other proteins in same PDB: d1zeta2
    automated match to d1t3na1
    protein/DNA complex; complexed with mg, ttp

Details for d1zeta1

PDB Entry: 1zet (more details), 2.3 Å

PDB Description: X-ray data do not support hoogsteen base-pairing during replication by human polymerase iota
PDB Compounds: (A:) polymerase (DNA directed) iota

SCOPe Domain Sequences for d1zeta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeta1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

SCOPe Domain Coordinates for d1zeta1:

Click to download the PDB-style file with coordinates for d1zeta1.
(The format of our PDB-style files is described here.)

Timeline for d1zeta1: