Lineage for d1zesc_ (1zes C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. Protein automated matches [190177] (9 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [186909] (5 PDB entries)
  8. Domain d1zesc_: 1zes C: [124996]
    automated match to d1b00a_
    complexed with bef, mg

Details for d1zesc_

PDB Entry: 1zes (more details), 1.9 Å

PDB Description: BeF3- activated PhoB receiver domain
PDB Compounds: (C:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d1zesc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zesc_ c.23.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr

SCOPe Domain Coordinates for d1zesc_ are not available.

Timeline for d1zesc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zesa_, d1zesb_