Lineage for d1zesb_ (1zes B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463980Protein automated matches [190177] (9 species)
    not a true protein
  7. 2464020Species Escherichia coli [TaxId:562] [186909] (5 PDB entries)
  8. 2464026Domain d1zesb_: 1zes B: [124995]
    automated match to d1b00a_
    complexed with bef, mg

Details for d1zesb_

PDB Entry: 1zes (more details), 1.9 Å

PDB Description: bef3- activated phob receiver domain
PDB Compounds: (B:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d1zesb_:

Sequence, based on SEQRES records: (download)

>d1zesb_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr

Sequence, based on observed residues (ATOM records): (download)

>d1zesb_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnwpdlilldwmlpggsgiqf
ikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr

SCOPe Domain Coordinates for d1zesb_:

Click to download the PDB-style file with coordinates for d1zesb_.
(The format of our PDB-style files is described here.)

Timeline for d1zesb_: