Lineage for d1zesa_ (1zes A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114998Protein automated matches [190177] (7 species)
    not a true protein
  7. 2115036Species Escherichia coli [TaxId:562] [186909] (5 PDB entries)
  8. 2115041Domain d1zesa_: 1zes A: [124994]
    automated match to d1b00a_
    complexed with bef, mg

Details for d1zesa_

PDB Entry: 1zes (more details), 1.9 Å

PDB Description: bef3- activated phob receiver domain
PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d1zesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zesa_ c.23.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr
i

SCOPe Domain Coordinates for d1zesa_:

Click to download the PDB-style file with coordinates for d1zesa_.
(The format of our PDB-style files is described here.)

Timeline for d1zesa_: