Lineage for d1zeea1 (1zee A:6-392)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016335Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2016336Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2016346Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 protein domains)
    Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615)
  6. 2016347Protein Hypothetical protein SO4414 [140964] (1 species)
  7. 2016348Species Shewanella oneidensis [TaxId:70863] [140965] (1 PDB entry)
    Uniprot Q8E972 6-392
  8. 2016349Domain d1zeea1: 1zee A:6-392 [124981]

Details for d1zeea1

PDB Entry: 1zee (more details), 2.31 Å

PDB Description: X-Ray Crystal Structure of Protein SO4414 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR52.
PDB Compounds: (A:) hypothetical protein SO4414

SCOPe Domain Sequences for d1zeea1:

Sequence, based on SEQRES records: (download)

>d1zeea1 a.266.1.2 (A:6-392) Hypothetical protein SO4414 {Shewanella oneidensis [TaxId: 70863]}
ynteafdewirsrfvelnsqleqlyyqqtdranvqevgtelkhtlesegrelvkalldeg
ntdegfdsafdllgnvglymaacrrheiteptrettsplleasalamhigasigvtprfa
tahltthnrahngiykrftdlpdeklfvdyntkgilaykrasdallkiqplgishpishd
llrvtkqalqdviesnqqlfnrldtdrffycvrpyykpyrvgsvvyrganagdfaginvi
dltlglcfaneasysqmlvdkflymmpedqqilrecmrrpnlmddflqakgcihqdwyqe
nlklfievcelhgqtaiqhhnelvtkyiaepsvsmeqqhlakvtasgpplhvllaslerl
rdrraavlrddirtryydlkklkdslr

Sequence, based on observed residues (ATOM records): (download)

>d1zeea1 a.266.1.2 (A:6-392) Hypothetical protein SO4414 {Shewanella oneidensis [TaxId: 70863]}
ynteafdewirsrfvelnsqleqlyyqqtdranvqevgtelkhtlesegrelvkalldeg
ntdegfdsafdllgnvglymaacrrheiteptrettsplleasalamhigasigvtprfa
tahltthnrahngiykrftdlpdeklfvdyntkgilaykrasdallkiqplgishpishd
llrvtkqalqdviesnqqlfnrldtdrffycvrpyykpyrvgsvvyrganagdfaginvi
dltlglcfaneasysqmlvdkflymmpedqqilrecmrrpnlmddflqakgcihqdwyqe
nlklfievcelhgqtaiqhhnelvtkyvllaslerlrdrraavlrddirtryydlkklkd
slr

SCOPe Domain Coordinates for d1zeea1:

Click to download the PDB-style file with coordinates for d1zeea1.
(The format of our PDB-style files is described here.)

Timeline for d1zeea1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zeeb_