Lineage for d1zeda1 (1zed A:1-479)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843772Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 843773Superfamily c.76.1: Alkaline phosphatase-like [53649] (5 families) (S)
  5. 843774Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
    common fold is decorated with several large insertions
  6. 843775Protein Alkaline phosphatase [53651] (3 species)
  7. 843841Species Human (Homo sapiens) [TaxId:9606] [64165] (5 PDB entries)
  8. 843842Domain d1zeda1: 1zed A:1-479 [124980]
    automatically matched to d1ew2a_
    complexed with ca, mg, nag, pnp, po3, zn

Details for d1zeda1

PDB Entry: 1zed (more details), 1.57 Å

PDB Description: alkaline phosphatase from human placenta in complex with p- nitrophenyl-phosphonate
PDB Compounds: (A:) alkaline phosphatase

SCOP Domain Sequences for d1zeda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeda1 c.76.1.1 (A:1-479) Alkaline phosphatase {Human (Homo sapiens) [TaxId: 9606]}
iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlapp

SCOP Domain Coordinates for d1zeda1:

Click to download the PDB-style file with coordinates for d1zeda1.
(The format of our PDB-style files is described here.)

Timeline for d1zeda1: