Lineage for d1zeda_ (1zed A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138455Family c.76.1.1: Alkaline phosphatase [53650] (2 protein domains)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2138558Protein automated matches [190176] (2 species)
    not a true protein
  7. 2138559Species Human (Homo sapiens) [TaxId:9606] [186907] (7 PDB entries)
  8. 2138562Domain d1zeda_: 1zed A: [124980]
    automated match to d1ew2a_
    complexed with ca, mg, nag, pnp, po3, zn

Details for d1zeda_

PDB Entry: 1zed (more details), 1.57 Å

PDB Description: Alkaline phosphatase from human placenta in complex with p-nitrophenyl-phosphonate
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d1zeda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeda_ c.76.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa
g

SCOPe Domain Coordinates for d1zeda_:

Click to download the PDB-style file with coordinates for d1zeda_.
(The format of our PDB-style files is described here.)

Timeline for d1zeda_: