SCOPe 2.07: Domain d1zeba_: 1zeb A:

Lineage for d1zeba_ (1zeb A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families)

5. Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
   common fold is decorated with several large insertions
   automatically mapped to Pfam PF00245

6. Protein automated matches [190176] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186907] (7 PDB entries)

8. Domain d1zeba_: 1zeb A: [124979]
   automated match to d1ew2a_
   complexed with ca, mg, nag, zn

Details for d1zeba_

PDB Entry: 1zeb, 1.9 Å

PDB Description: x-ray structure of alkaline phosphatase from human placenta in complex with 5'-amp

PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d1zeba_:

Sequence; same for both SEQRES and ATOM records:

>d1zeba_ c.76.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa

Timeline for d1zeba_:

• d1zeba_ first appeared in SCOP 1.73, called d1zeba1
  
• d1zeba_ appears in SCOPe 2.06
  
• d1zeba_ appears in the current release, SCOPe 2.08