SCOP 1.73: Domain d1zeba1: 1zeb A:1-479

Lineage for d1zeba1 (1zeb A:1-479)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (5 families)

5. Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
   common fold is decorated with several large insertions

6. Protein Alkaline phosphatase [53651] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64165] (5 PDB entries)

8. Domain d1zeba1: 1zeb A:1-479 [124979]
   automatically matched to d1ew2a_
   complexed with ca, mg, nag, po3, zn

Details for d1zeba1

PDB Entry: 1zeb, 1.9 Å

PDB Description: x-ray structure of alkaline phosphatase from human placenta in complex with 5'-amp

PDB Compounds: (A:) alkaline phosphatase

SCOP Domain Sequences for d1zeba1:

Sequence; same for both SEQRES and ATOM records:

>d1zeba1 c.76.1.1 (A:1-479) Alkaline phosphatase {Human (Homo sapiens) [TaxId: 9606]}
iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlapp

Timeline for d1zeba1:

• d1zeba1 is new in SCOP 1.73
  
• d1zeba1 appears in SCOP 1.75
  
• d1zeba1 appears in the current release, SCOPe 2.08, called d1zeba_